GenomeNet

>bsu:BSU00210 K06187 recombination protein RecR | (RefSeq) recR; recombination protein RecR (A)
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL

BLAST