GenomeNet

>bsu:BSU00240 no KO assigned | (RefSeq) csfB; sporulation protein CsfB (A)
MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYAFYVKKLKSIHTP
PLYS

BLAST