GenomeNet

>bsu:BSU00440 no KO assigned | (RefSeq) veg; protein Veg (A)
MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSVFVIQLDQDENSFERV
SYSYADILTETVELTFNDDAASSVAF

BLAST