GenomeNet

>bsu:BSU00450 K06423 small acid-soluble spore protein F (minor alpha/beta-type SASP) | (RefSeq) sspF; small acid-soluble spore protein SspF (A)
MGRRRGVMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKRAIEIAEQQMAQNQNN
R

BLAST