GenomeNet

>bsu:BSU00540 no KO assigned | (RefSeq) yabK; hypothetical protein (A)
MALHYYCRHCGVKVGSLESSMVSTDSLGFQHLTNEERNDMISYKENGDVHVLTICEDCQE
ALDRNPHYHEYHTFIQ

BLAST