GenomeNet

>bsu:BSU00580 K02499 tetrapyrrole methylase family protein / MazG family protein | (RefSeq) yabN; hypothetical protein (A)
MAGKITVVGLGAGDMDQLTIGIHKLLTKADTLYVRTKDHPLIEELEKETKNIRFFDDIYE
KHDQFEAVYEEIADILFEAARREDVVYAVPGHPFVAEKTVQLLTERQEKENVQVKVAGGQ
SFLDATFNVLQIDPIEGFQFVDAGTLSADELELRHHLIICQVYDQMTASEVKLTLMEKLP
DDYEVVIVTAAGSRGEEIRTVPLFELDRNVALNNLTSVYIPPIKEEKLLYHEFSTFRSII
RELRGPNGCPWDKKQTHQSLKQYMIEECYELLEAIDEEDTDHMIEELGDVLLQVLLHAQI
GEDEGYFTIDDVIKGISEKMVRRHPHVFKDVKVQDENDVLANWEDIKKAEKNTSESSLLD
SVPKTLPALSKAAKLQKKAAKVGFDWEDVSDIWEKVSEEMKEFSSEVSEAPHEHNLKAEF
GDILFALVNVARFYKIEPEEALTMTNDKFRRRFSYIEETAKEEGVELADMSLEDMDKLWN
EAKETERRS

BLAST