GenomeNet

>bsu:BSU00610 no KO assigned | (RefSeq) yabQ; spore protein YabQ (A)
MTLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAKTARWLLFIHDILFWIMQGLLFFYVL
LHVNEGEFRIYIFLAVLLGVATYQSLCKRIYIKILKFVIYLVVSVYQFFKKLIQHVLFRP
IVWTCGAIIWLAAFLFKKTYSLIGFLLLCLYKIVMVLCFPIRFIAKQCLKLLPVKMRLTF
RRYFEKGAGFLKKKKKLLITIRTTITRFLKR

BLAST