GenomeNet

>bsu:BSU00650 K07114 Ca-activated chloride channel homolog | (RefSeq) yabS; hypothetical protein (A)
MNNGHLNQILLITDGCSNHGEDPLAMAAFAKEQGITVNVIGIMEENQIDPEAMKEVEGIA
LAGGGVHQVVYASQLSQTVQMVTKKAMTQTLQGVVNQELKQILGKNVEMEELSPEKRGEV
MEVVDELGETVHLQVLVLVDTSASMAPKLPTVKEALIDLSVSLNSRIGNNEFAMCIFPGK
KQEVELVLNWTPKLQSLSTLFAKLSTGGITPTGPAIREATLQFEKIRSRRGMLADDERRF
DEFGM

BLAST