GenomeNet

>bsu:BSU01060 K00564 16S rRNA (guanine1207-N2)-methyltransferase [EC:2.1.1.172] | (RefSeq) ybxB; hypothetical protein (A)
MSEHYYSEKPSVKSNKQTWSFRLRNKDFTFTSDSGVFSKKEVDFGSRLLIDSFEEPEVEG
GILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQNGITNVKIYQSDLFSN
VDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIVIQKKQGAPSAIEKLEEL
FDEVSVVQKKKGYYIIKAKKV

BLAST