GenomeNet

>bsu:BSU01110 K02992 small subunit ribosomal protein S7 | (RefSeq) rpsG; 30S ribosomal protein S7 (A)
MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYKSFDIIKERTGNDAME
VFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERL
ANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW

BLAST