GenomeNet

>bsu:BSU01180 K02892 large subunit ribosomal protein L23 | (RefSeq) rplW; 50S ribosomal protein L23 (A)
MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYK
GKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA

BLAST