GenomeNet

>bsu:BSU01240 K02904 large subunit ribosomal protein L29 | (RefSeq) rpmC; 50S ribosomal protein L29 (A)
MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAIARMKTVIRER
EIAANK

BLAST