GenomeNet

>bsu:BSU01260 K02874 large subunit ribosomal protein L14 | (RefSeq) rplN; 50S ribosomal protein L14 (A)
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGGVVKKGEVVKA
VIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVARELRENNFMKIVSLAPE
VI

BLAST