GenomeNet

>bsu:BSU01270 K02895 large subunit ribosomal protein L24 | (RefSeq) rplX; 50S ribosomal protein L24 (A)
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQE
APIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK

BLAST