GenomeNet

>bsu:BSU01320 K02881 large subunit ribosomal protein L18 | (RefSeq) rplR; 50S ribosomal protein L18 (A)
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLD
KDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF

BLAST