GenomeNet

>bsu:BSU01350 K02876 large subunit ribosomal protein L15 | (RefSeq) rplO; 50S ribosomal protein L15 (A)
MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQR
LPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKK
LTVKANKFSASAKEAVEAAGGTAEVI

BLAST