GenomeNet

>bsu:BSU01360 K03076 preprotein translocase subunit SecY | (RefSeq) secY; protein translocase subunit SecY (A)
MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQAQSQMGVFDLLNTFG
GGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEVGRRKLAQFTRYFTIVL
GFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFLMWLGEQITSHGVGNGIS
IIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVIAILAVIVGVIFIQQAVRK
IAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFLITPRTIASFFGTNDVTKWI
QNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNLKKQGGYIPGVRPGKMTQDRI
TSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGGTSLLIVVGVALETMKQLESQL
VKRNYRGFMKN

BLAST