GenomeNet

>bsu:BSU01400 K02919 large subunit ribosomal protein L36 | (RefSeq) rpmJ; 50S ribosomal protein L36 (A)
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG

BLAST