GenomeNet

>bsu:BSU01490 K02871 large subunit ribosomal protein L13 | (RefSeq) rplM; 50S ribosomal protein L13 (A)
MRTTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGDHVIIINA
EKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLELAIKGMLPKGSLGRQMF
KKLNVYRGSEHPHEAQKPEVYELRG

BLAST