GenomeNet

>bsu:BSU01600 K07017 uncharacterized protein | (RefSeq) ybbA; hypothetical protein (A)
MKGSLSEHKAGNRRFTLYLPPSYSTDSGGFPAVYVQDGSSLFQNQIELLESAFQQQRLPE
LVLIGIEPENRLDEYTPWPAASLSDRFTDFGGMGYHYLSDITNQFIPLIEENWNVTREPQ
SRGMIGASLGGLISMFAILKYPSMFGKIGSISGSYWYENAAETIHISSLKPGTARVFMSI
GSEEGREKQSIQRHMLKKTKQVHQSLKEKGFTEDQLCLSIEKGAVHHHKYFCKQFINALE
WLYGKNRSTL

BLAST