GenomeNet

>bsu:BSU01630 K02016 iron complex transport system substrate-binding protein | (RefSeq) feuA; iron-uptake system-binding protein (A)
MKKISLTLLILLLALTAAACGSKNESTASKASGTASEKKKIEYLDKTYEVTVPTDKIAIT
GSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEPTGEKMEPNIEKILEMKPDVIL
ASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLAQLTGKEKKAKKIIADYEQDLKEI
KTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLE
KLSEMNPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAVKEDHVYVNSVDPLAQGGTA
WSKVRFLKAAAEKLTQN

BLAST