GenomeNet

>bsu:BSU01720 no KO assigned | (RefSeq) ybbK; hypothetical protein (A)
MILVSSCLGGIECRYNGSHAASEKIRKLVDEKKAVMACPELLGGFSTPREPAEIIGGTGE
DVLNGTAKIVTASGEDVTELYMEGAAKTLAYAKEINASAVILKENSPSCGSGFIYNGTFS
GKKITGSGVTAALLKQAGYRVISENELNDIL

BLAST