GenomeNet

>bsu:BSU02080 no KO assigned | (RefSeq) ybxH; hypothetical protein (A)
MGAIERSGYTFQPEFSVVRQNGAIHVYHQGEFVEEIEFEFNGEYPDHDLIEELVNHYCFE
HEI

BLAST