GenomeNet

>bsu:BSU02280 no KO assigned | (RefSeq) ybfM; hypothetical protein (A)
MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTDVLNYELSILISFVGA
LLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYGPYSLILGYFIPGVRHV
TCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV

BLAST