GenomeNet

>bsu:BSU02300 no KO assigned | (RefSeq) ybfN; hypothetical protein (A)
MEKQIISWITDYQNTGDEAVLRQVREVCWPIVEAVLQEKVMDDEQANNLREKGIERFPFI
ISKYQADVQLPVETFLQNTYRFYFHQVMRESS

BLAST