GenomeNet

>bsu:BSU02350 K02765 D-glucosamine PTS system EIICBA component [EC:2.7.1.-] | (RefSeq) nagP; PTS system-glucosamine-specific transporter subunit EIICBA (A)
MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKDAGGVVFDNLPLIFAV
GVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGAEHLIDMGVFGGIIIGL
LAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFSFVWPLIQNGINAASSLI
ADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPSTGNTVTGDLTRFFAGDPTA
GRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISAALTSMLTGITEPVEFSFLF
VAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVLNYGLSTNGWVVIPVGIVFAF
IYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQLAFHVLQALGGQQNIANLDACI
TRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFGTKSDALKDDIKTIMAGGVPATA
AALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQVFSEKMMGEGFAIIPSEGKVVAPA
DGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLNGEGFEAHVTSGQAVKQGELLLTFD
LNYIKQHAASAITPVIFTNTSEEDLKHIQMK

BLAST