GenomeNet

>bsu:BSU02580 no KO assigned | (RefSeq) ycbO; hypothetical protein (A)
MNLIRIELRKMKMGWYIRGALIANVIIMGFMWLISYSEKADGGVSFQSTDEAFLIIGTFV
RAVFIVFGAVLIVKLVISEYKNKTILVMFTYPISRKKLLTAKLMIAGGLTFITILLSNIL
IAAGFFWLNSICHFIPGELTSEIISQQAVKMAVFAFGAAGTSLVPIFFGMRRHSVPATII
SSVVIVMLISSTSPGFSISSVVYIPLSLAAFGLFFSYMAIRNADKQDA

BLAST