GenomeNet

>bsu:BSU02590 no KO assigned | (RefSeq) ycbP; hypothetical protein (A)
MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMI
ATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKH
YLETRTDS

BLAST