GenomeNet

>bsu:BSU02610 no KO assigned | (RefSeq) ycbR; hypothetical protein (A)
MATIDLQKKSVKIVLEKKQLTKVTARVGLVLDITGSMRPLYKNGTVQNVVERILAVADQF
DDNGLLDVWVYDNEFSRLKPVSEKDFSGYVDREILNNDRLHKFGRNDEPPVMKDVLRKYV
TEEPSSYPAFIVFINDGGCKKSIKPIIEASSDKPVFWQFVGIGNGNFDFLNKLDTLEGRV
IDNTNFLHIEEIDRISDDELYDALLAEFPFWLKEAKEKGIVREQEPPAEKPKKKGFFSRL
FSK

BLAST