GenomeNet

>bsu:BSU02730 K11640 two-component system, LytTR family, sensor histidine kinase NatK [EC:2.7.13.3] | (RefSeq) natK; sensor histidine kinase (A)
MITLFQCLYLILFSFICYQGAAAFSHSTAASWLAAALGAAAAGLYIWNTKRVWKHCSSGL
CAWIAVIQVMSVGVVLIGTDIMPVLCVIAIFAGCEGLRIGQSALQARLSDQIDKLTQAEQ
HANQMLIDVRSRNHDTMKHITAIKSAQPKADTQAYIQNWADQYSQYDRFLKGENAYVAGV
LYDFLEKARASNVSVSLHMHTPLSSLPFSPADQVSLVGNILENALDSAAEAREKAEIKLE
TSLRSGLYVLTCENSTPGMDPKVLDTIYQSFGRSTKNGAHEGMGTYIIQKLVKGAFGRLD
FTYRHPIFRLEIKIPFQK

BLAST