GenomeNet

>bsu:BSU02860 K09817 zinc transport system ATP-binding protein [EC:3.6.3.-] | (RefSeq) adcC; zinc transport system ATP-binding protein AdcC (A)
MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTLIKVMLGMLKPWEGTV
TISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKGKWFKRLNEEDHLEVEK
ALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDEPTTAVDYDSRKGFYEFM
HHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCLTWNSCDELF

BLAST