GenomeNet

>bsu:BSU02910 K05795 tellurium resistance protein TerD | (RefSeq) yceE; hypothetical protein (A)
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLD
FVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQ
NFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYRHGGEWKFNAIGSGFSGG
LAALCRNYGLQV

BLAST