GenomeNet

>bsu:BSU02940 no KO assigned | (RefSeq) yceH; hypothetical protein (A)
MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLAQQIDVKNQMELLEYGKEPAVE
ISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKGLMAKIFKRGGSMIEKI
FKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYYMELEKYVVAGQMKLEEM
QSILPSYEEKAASGNQLAQMQLDTLRNGIQALEERVYDLDMARMVALQTAPQIRLLQRGN
AKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSELDRRTNEMLKRNAENISSQS
VEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKRLREDGARRIAQLQDNIKKAA
LQQ

BLAST