GenomeNet

>bsu:BSU03150 K00891 shikimate kinase [EC:2.7.1.71] | (RefSeq) aroK; shikimate kinase (A)
MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQIEKDFNMSIPEIFEK
KGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLENCLVLHLDLSWENWKQ
RADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNLSPEEVADYIVETLKIGW
DLYQPM

BLAST