GenomeNet

>bsu:BSU03370 K10009 L-cystine transport system permease protein | (RefSeq) yckA; amino acid ABC transporter permease protein YckA (A)
MINSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV

BLAST