GenomeNet

>bsu:BSU03380 K02424 L-cystine transport system substrate-binding protein | (RefSeq) yckB; ABC transporter substrate-binding protein (A)
MKSFMHSKAVIFSFTMAFFLILAACSGKNEADSKDTGWEQIKDKGKIVVATSGTLYPTSY
HDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKD
REEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVI
YDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKS
NAALQKKMNEALKEMSKDGSLTKLSKQFFNKADVSKKIDADVQDVDL

BLAST