GenomeNet

>bsu:BSU03820 K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] | (RefSeq) yclP; ABC transporter ATP-binding protein (A)
MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEIYI
DGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYSQGRLTEEDWVHINQAL
SYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPLNNLDMKHSVEIMKLLKR
LVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEEMIETSVLEEIYDMTIPIQ
TIDNQRIGVYFS

BLAST