GenomeNet

>bsu:BSU03940 no KO assigned | (RefSeq) ycnI; hypothetical protein (A)
MLKKIALTLCPAIVGSLLFFTAPASAHVSVKPAESAAGSWETYTMKVPSEKNLPTTKVVL
KMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATDGGIQEGQFQQFTFVAKNPDKAEE
AAWDAYQYYKDGSIVEWTGDEDADTPHSITNITSAKQVTDEHGATKTEDDSENSGSSALD
ITAMVLSAAAIILSVAALVKKKRA

BLAST