GenomeNet

>bsu:BSU04070 no KO assigned | (RefSeq) ycsI; hypothetical protein (A)
MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLFCQRNQKPCPVLDVTE
AGSPVPSLAAPDADIRTDFPKYRIYRHGILTEEVSDITPYWEDDFVGFLIGCSFSFEQAL
INNGIAVRHIDEGTNVSMYKTNIDCVPAGAFHGQMVVSMRPVPERLAVRAAQVTSRFPAV
HGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGVTPQAVAMNVKPEMVITHA
PGHMLITDIRDESLAVL

BLAST