GenomeNet

>bsu:BSU04450 K11691 two-component system, CitB family, sensor histidine kinase DctS [EC:2.7.13.3] | (RefSeq) dctS; C4-dicarboxylate sensor kinase (A)
MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKKRLMNTARTVSEMTEV
KEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVSTSIGKKSEGADEEAAF
AEHIYFSEAKGEIGTAVRAFYPVKDQDLNQIGVVLVGKTLPGIADILLHLKRDIAFIVVL
TLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSMNEGVIAIDNRLVITIFNE
KAKQIFEVQGDLIGKVIWEVLKDSRLPEIVERNKAVYNEEIRVSGKVIMSSRIPIVMKKK
VIGAVAIFQDRTEAAKMAEELTGVRNFVEALRVQNHEHMNKLHTIAGLIQLGKSEKALQL
AFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELGIAVHIDENSSLQQFPEHVDQH
DIVVLLGNLIENAFGSFETVQSEDKRIDISIEQTDDILAILIEDNGCGIEPTHMPRLYDK
GFTVNKTGGTGYGLYLVKQIIDKGSGTIEVDSHAGQGTSFSIVFPMKGEEAQHGS

BLAST