GenomeNet

>bsu:BSU04750 no KO assigned | (RefSeq) ydcF; hypothetical protein (A)
MERKEHCFCKEKQFSYGLSMWRNIGRFLSWSTCPHSNVIMEFFHVLQKQKEDLCITYGIV
LEGAEAKKWGEIIGTELSKDMPTAVSRLVHLYGGVIK

BLAST