GenomeNet

>bsu:BSU05280 no KO assigned | (RefSeq) ydeO; hypothetical protein (A)
MNTPKKHKKFKAKMILQIIMVIIGGIIAAYGLETVLIPNSVSDGGVTGLSIVGSQLFNLP
LGILIAVINIPFVWLGYKQIGKSFALLSIIGIVSLAAGTSFFHHTPAIIEGDTLLITVVG
GIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFLNLFVFIFVSTVFGLQGA
LLSVIAYYIASKVIHVVEEGLSGSKTFQIITTQPELMVETIRDQLGRSATYKEAYGGFSH
EKFKEITCVINRLEETKLKEIINDIDKTAFVTVYDVAEVKGSNFRNLNHH

BLAST