GenomeNet

>bsu:BSU05490 K15975 glyoxalase family protein | (RefSeq) ydfO; ring-cleaving dioxygenase MhqO (A)
MAKKTMGIHHITAIVGHPQENTDFYAGVLGLRLVKQTVNFDDPGTYHLYFGNEGGKPGTI
ITFFPWAGARQGVIGDGQVGVTSYVVPKGAMAFWEKRLEKFNVPYTKIERFGEQYVEFDD
PHGLHLEIVEREEGEANTWTFGEVTPDVAIKGFGGATLLSEQPDKTADLLENIMGLERVG
KEGDFVRYRSAGDIGNVIDLKLTPIGRGQMGAGTVHHIAWRANDDEDQLDWQRYIASHGY
GVTPVRDRNYFNAIYFREHGEILFEIATDPPGFAHDETQETMGEKLMLPVQYEPHRTQIE
QGLLPFEVRELD

BLAST