GenomeNet

>bsu:BSU05960 K03637 cyclic pyranopterin monophosphate synthase [EC:4.6.1.17] | (RefSeq) moaC; cyclic pyranopterin monophosphate synthase accessory protein (A)
MNGFSHFNEQGRAQMVDISEKSSTVRTAAAVSSVHMKNEVYEKIQSHDIGKGDVLAVAQV
AGIMAAKQTSNIIPMCHPLSLSGVDISFDWKIKEAEVILHIKAQVKTKGSTGVEMEALTS
ASVCALTVYDMCKALDKGMVIGPTFLLEKTGGKNGDFKRELSEYNLEDQK

BLAST