GenomeNet

>bsu:BSU05980 K03116 sec-independent protein translocase protein TatA | (RefSeq) tatAY; Sec-independent protein translocase protein TatAy (A)
MPIGPGSLAVIAIVALIIFGPKKLPELGKAAGDTLREFKNATKGLTSDEEEKKKEDQ

BLAST