GenomeNet

>bsu:BSU06180 K03969 phage shock protein A | (RefSeq) pspA; phage shock protein A homolog (A)
MSIIGRFKDIMSANINALLDKAENPEKMVDQYLRNMNSDLAKVKAETAAVMAEEQRAKRE
YHECQADMEKMESYAMKALQAGNESDARKFLERKTSLESKLSELQAANQIAATNAAQMRK
MHDKLVSDIGELEARKNMIKAKWAVAKTQERMNKLGASVSSTSQSMSAFGRMEDKVNKAL
DQANAMAELNSAPQDDMADLSAKYDTGGSSQVDDELAALKAKMMLDK

BLAST