GenomeNet

>bsu:BSU06200 K06872 uncharacterized protein | (RefSeq) ydjH; hypothetical protein (A)
MRGFFGKAIFVVLAVFIMMPLLGIEAVRASELQQHVYDRAHLLSKAEIGKLESLSAKLGA
KRDTDFIIITTKSTNGEDIADYTGDFYDRYGKGSTAILTIDMTNREVFIAGFKKAEQYLD
NSRLNSIRNTISSDLSNENYFEAFETYIQLSYKDMGIKPGVNPDNIFFTWWFQLIAAIAV
GGIAVSIMLYHAGGKVTVNGSTYMDQRTSDVIDQYDTYIRTTVTRERKPSDKDSGSDGGV
TKGGTSYSGSRGSF

BLAST