GenomeNet

>bsu:BSU06220 no KO assigned | (RefSeq) ydjJ; hypothetical protein (A)
MNEGYIIAGLLLLTAGMIDFLWTTLWLESGAGPITRCLSAWLWKGCRKISGDHAKVLSMA
GPLLLCLTLVIWISLFWSGWVLIYSSDPHSLMETQSKEPASWSDRIYFSGYVMFTLGNGD
LAPNGGLWKLVTIIETAQGLLTITFSVTYLISVLSAVNQKRSFAQSVLSLGHDGTEIVHN
AWNGKDFHDIDFLLVAASSELGKLTAQHNAFPILHFYHSTQHQESSIIAVAVLDEALTIF
KYGIPEQYQPNQLHIKEARSSIKNYLDTVHTAYIHPAEQAPPEPDISKLQQSGIPALSKQ
TFQIAVNSIKERRQLLLGIIQAGARKWPVQEQAIGNAYSPK

BLAST