GenomeNet

>bsu:BSU06340 no KO assigned | (RefSeq) yeaD; hypothetical protein (A)
MNKKWQWLVYGWKLIILTLLTAAVFSYAMFQGGFVSWFLFYAFLPFVLYAGLLALYPLRS
FQASRQMDKTQLHAGDRLGVTVTLRRKLPFPLMYMVIEDCLPEGIESLNRDGAAAKRLVF
PWFKRSMTMSYELARVPRGEHHFHSVRVRTGDVLGLIEKTAFFELDDTLFVYPFYQRFSY
QVNERHQEDGVSGSSPIHQHHSSVAASVRNYQPGDRFAALDWKTSARRSQLMTKEFEPSR
SKNLFLLMDRFSSDAFEEVVSVTASILHSVLKNGAGAGLASIGKEKNIFPIQEGDQHFKH
MLRHLAIAHCDAADPISRYAREELGKPSVRQADQVVVTGQLTEDMLHLAEIGGGRVTVIL
AKEKDAELSQAENVMIERMMKRQIRVRIMRGGRVSRVV

BLAST