GenomeNet

>bsu:BSU06580 no KO assigned | (RefSeq) yerC; hypothetical protein (A)
MQIDKLRGKELDQLFNSILSLKDLEECYRFFDDLCTINEIQSLAQRLEVARMLREGNTYH
KIETETGASTATISRVKRCLNYGNDAYEMALDRVKETETESSSK

BLAST